PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G74080.1
Common NameATMYB122, F2P9.5, MYB122
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 333aa    MW: 37255.4 Da    PI: 6.7865
Description myb domain protein 122
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G74080.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.6e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +v+++G g W+t + + g++R++k+c++rw +yl
      AT1G74080.1 14 KGAWTQEEDQKLIAYVQRHGEGGWRTLPDKAGLKRCGKSCRLRWANYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.94.1e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg ++++E++ ++++++ +G++ W++Iar+++ +Rt++++k++w+++
      AT1G74080.1  67 RGEFSQDEEDSIINLHAIHGNK-WSAIARKIP-RRTDNEIKNHWNTH 111
                      899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.372961IPR017930Myb domain
SuperFamilySSF466894.87E-2911108IPR009057Homeodomain-like
SMARTSM007172.4E-131363IPR001005SANT/Myb domain
PfamPF002495.0E-161461IPR001005SANT/Myb domain
CDDcd001676.27E-101661No hitNo description
PROSITE profilePS5129423.84462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-2465116IPR009057Homeodomain-like
SMARTSM007171.6E-1566114IPR001005SANT/Myb domain
PfamPF002493.8E-1567111IPR001005SANT/Myb domain
CDDcd001673.47E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009625Biological Processresponse to insect
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0009506Cellular Componentplasmodesma
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MVRTPCCRAE GLKKGAWTQE EDQKLIAYVQ RHGEGGWRTL PDKAGLKRCG KSCRLRWANY  60
LRPDIKRGEF SQDEEDSIIN LHAIHGNKWS AIARKIPRRT DNEIKNHWNT HIKKCLVKKG  120
IDPLTHKSLL DGAGKSSDHS AHPEKSSVHD DKDDQNSNNK KLSGSSSARF LNRVANRFGH  180
RINHNVLSDI IGSNGLLTSH TTPTTSVSEG ERSTSSSSTH TSSNLPINRS ITVDATSLSS  240
STFSDSPDPC LYEEIVGDIE DMTRFSSRCL SHVLSHEDLL MSVESCLENT SFMREITMIF  300
QEDKIETTSF NDSYVTPINE VDDSCEGIDN YFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26121145106B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible260394_at0.0
Expression AtlasAT1G74080-
AtGenExpressAT1G74080-
ATTED-IIAT1G74080-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in trichomes. {ECO:0000269|PubMed:23115560}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor, member of the R2R3 factor gene family (MYB122).
UniProtTranscription factor involved in glucosinolates biosynthesis. {ECO:0000269|PubMed:23580754, ECO:0000269|PubMed:23943862}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G74080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Low levels of indolic glucosinolates and loss of responses to brassinosteroids. {ECO:0000269|PubMed:23580754}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G74080
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719830.0AF371983.2 Arabidopsis thaliana putative transcription factor MYB122 (MYB122) mRNA, complete cds.
GenBankBT0289310.0BT028931.1 Arabidopsis thaliana At1g74080 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177548.10.0myb domain protein 122
SwissprotQ9C9C80.0MY122_ARATH; Transcription factor MYB122
TrEMBLD7KRY91e-172D7KRY9_ARALL; MYB122
STRINGAT1G74080.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Stanley Kim H, et al.
    Transcriptional divergence of the duplicated oxidative stress-responsive genes in the Arabidopsis genome.
    Plant J., 2005. 41(2): p. 212-20
    [PMID:15634198]
  4. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  5. Malitsky S, et al.
    The transcript and metabolite networks affected by the two clades of Arabidopsis glucosinolate biosynthesis regulators.
    Plant Physiol., 2008. 148(4): p. 2021-49
    [PMID:18829985]
  6. Fernandez-Calvino L, et al.
    Arabidopsis plasmodesmal proteome.
    PLoS ONE, 2011. 6(4): p. e18880
    [PMID:21533090]
  7. Frerigmann H,B
    Glucosinolates are produced in trichomes of Arabidopsis thaliana.
    Front Plant Sci, 2012. 3: p. 242
    [PMID:23115560]
  8. Mewis I,Khan MA,Glawischnig E,Schreiner M,Ulrichs C
    Water stress and aphid feeding differentially influence metabolite composition in Arabidopsis thaliana (L.).
    PLoS ONE, 2012. 7(11): p. e48661
    [PMID:23144921]
  9. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  10. Guo R, et al.
    BZR1 and BES1 participate in regulation of glucosinolate biosynthesis by brassinosteroids in Arabidopsis.
    J. Exp. Bot., 2013. 64(8): p. 2401-12
    [PMID:23580754]
  11. Schweizer F, et al.
    Arabidopsis basic helix-loop-helix transcription factors MYC2, MYC3, and MYC4 regulate glucosinolate biosynthesis, insect performance, and feeding behavior.
    Plant Cell, 2013. 25(8): p. 3117-32
    [PMID:23943862]
  12. Frerigmann H,Berger B,Gigolashvili T
    bHLH05 is an interaction partner of MYB51 and a novel regulator of glucosinolate biosynthesis in Arabidopsis.
    Plant Physiol., 2014. 166(1): p. 349-69
    [PMID:25049362]